SCOP 1.61: Domain d1bif_1: 1bif 37-249

Lineage for d1bif_1 (1bif 37-249)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.7: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52589] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52590] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52591] (3 PDB entries)

8. Domain d1bif_1: 1bif 37-249 [31961]
   Other proteins in same PDB: d1bif_2

Details for d1bif_1

PDB Entry: 1bif, 2 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate

SCOP Domain Sequences for d1bif_1:

Sequence; same for both SEQRES and ATOM records:

>d1bif_1 c.37.1.7 (37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus)}
cptlivmvglpargktyiskkltrylnfigvptrefnvgqyrrdmvktyksfefflpdne
eglkirkqcalaalndvrkflseegghvavfdatnttrerramifnfgeqngyktffves
icvdpeviaanivqvklgspdyvnrdsdeatedfmrriecyensyesldeeqdrdlsyik
imdvgqsyvvnrvadhiqsrivyylmnihvtpr

Timeline for d1bif_1:

• d1bif_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bif_1 appears in SCOP 1.59
  
• d1bif_1 appears in SCOP 1.63
  
• d1bif_1 appears in the current release, SCOPe 2.08, called d1bifa1