Lineage for d1bif_1 (1bif 37-249)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69643Family c.37.1.7: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52589] (1 protein)
  6. 69644Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52590] (1 species)
  7. 69645Species Rat (Rattus norvegicus) [TaxId:10116] [52591] (3 PDB entries)
  8. 69646Domain d1bif_1: 1bif 37-249 [31961]
    Other proteins in same PDB: d1bif_2

Details for d1bif_1

PDB Entry: 1bif (more details), 2 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate

SCOP Domain Sequences for d1bif_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bif_1 c.37.1.7 (37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus)}
cptlivmvglpargktyiskkltrylnfigvptrefnvgqyrrdmvktyksfefflpdne
eglkirkqcalaalndvrkflseegghvavfdatnttrerramifnfgeqngyktffves
icvdpeviaanivqvklgspdyvnrdsdeatedfmrriecyensyesldeeqdrdlsyik
imdvgqsyvvnrvadhiqsrivyylmnihvtpr

SCOP Domain Coordinates for d1bif_1:

Click to download the PDB-style file with coordinates for d1bif_1.
(The format of our PDB-style files is described here.)

Timeline for d1bif_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bif_2