Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Rhinovirus c [TaxId:463676] [319565] (2 PDB entries) |
Domain d5k0ub_: 5k0u B: [319608] automated match to d1d4m3_ |
PDB Entry: 5k0u (more details), 2.79 Å
SCOPe Domain Sequences for d5k0ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k0ub_ b.121.4.0 (B:) automated matches {Rhinovirus c [TaxId: 463676]} glptrlpsgsqqfmttedeqspnilpgfhpskkihipgmitnvmhmarvdsfipinniqg evgkvsmyyitvtkktvterilvlplemsntlfattllgevlnyyanwsgsititfmcvc dafstgkflvaytppggklpedrkqamlgvhiiwdlglqssctivvpwissgfyrrtkad sfthggyvslwyqtafvppvsggtgsilatcsacpdmsvrmlrdspmmeqknelq
Timeline for d5k0ub_: