Lineage for d5k0ub_ (5k0u B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087338Species Rhinovirus c [TaxId:463676] [319565] (2 PDB entries)
  8. 2087340Domain d5k0ub_: 5k0u B: [319608]
    automated match to d1d4m3_

Details for d5k0ub_

PDB Entry: 5k0u (more details), 2.79 Å

PDB Description: cryoem structure of the full virion of a human rhinovirus c
PDB Compounds: (B:) capsid protein vp3

SCOPe Domain Sequences for d5k0ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k0ub_ b.121.4.0 (B:) automated matches {Rhinovirus c [TaxId: 463676]}
glptrlpsgsqqfmttedeqspnilpgfhpskkihipgmitnvmhmarvdsfipinniqg
evgkvsmyyitvtkktvterilvlplemsntlfattllgevlnyyanwsgsititfmcvc
dafstgkflvaytppggklpedrkqamlgvhiiwdlglqssctivvpwissgfyrrtkad
sfthggyvslwyqtafvppvsggtgsilatcsacpdmsvrmlrdspmmeqknelq

SCOPe Domain Coordinates for d5k0ub_:

Click to download the PDB-style file with coordinates for d5k0ub_.
(The format of our PDB-style files is described here.)

Timeline for d5k0ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5k0ua_