Lineage for d5kdta_ (5kdt A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163805Species Human (Homo sapiens) [TaxId:9606] [193730] (31 PDB entries)
  8. 2163840Domain d5kdta_: 5kdt A: [319603]
    Other proteins in same PDB: d5kdtb_
    automated match to d5i2ja_
    complexed with 6rv, act, glu, gly

Details for d5kdta_

PDB Entry: 5kdt (more details), 2.44 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with gne0723
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5kdta_:

Sequence, based on SEQRES records: (download)

>d5kdta_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgich

Sequence, based on observed residues (ATOM records): (download)

>d5kdta_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnhlsivtleeapfvivedidpetcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
svpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgich

SCOPe Domain Coordinates for d5kdta_:

Click to download the PDB-style file with coordinates for d5kdta_.
(The format of our PDB-style files is described here.)

Timeline for d5kdta_: