SCOP 1.67: Domain d1esnc_: 1esn C:

Lineage for d1esnc_ (1esn C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins)

6. Protein Pantothenate kinase PanK [52587] (1 species)
   has a circularly permuted fold compared to the phosphoribulokinase fold

7. Species Escherichia coli [TaxId:562] [52588] (2 PDB entries)

8. Domain d1esnc_: 1esn C: [31959]

Details for d1esnc_

PDB Entry: 1esn, 2.6 Å

PDB Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a

SCOP Domain Sequences for d1esnc_:

Sequence; same for both SEQRES and ATOM records:

>d1esnc_ c.37.1.6 (C:) Pantothenate kinase PanK {Escherichia coli}
lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
aveevrlrk

Timeline for d1esnc_:

• d1esnc_ first appeared (with stable ids) in SCOP 1.55
  
• d1esnc_ appears in SCOP 1.65
  
• d1esnc_ appears in SCOP 1.69
  
• d1esnc_ appears in the current release, SCOPe 2.08