Lineage for d5f28c_ (5f28 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569729Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2569730Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2569731Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2569768Protein automated matches [191130] (2 species)
    not a true protein
  7. 2569779Species Mouse (Mus musculus) [TaxId:10090] [319497] (1 PDB entry)
  8. 2569782Domain d5f28c_: 5f28 C: [319584]
    Other proteins in same PDB: d5f28e_, d5f28f_, d5f28g_
    automated match to d3p57j_

Details for d5f28c_

PDB Entry: 5f28 (more details), 2.9 Å

PDB Description: crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
PDB Compounds: (C:) mef2c

SCOPe Domain Sequences for d5f28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f28c_ d.88.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tftkrkfglmkkayelsvlcdceialiifnstnklfqyastdmdkvllkyteynephesr
tnsdivealnkk

SCOPe Domain Coordinates for d5f28c_:

Click to download the PDB-style file with coordinates for d5f28c_.
(The format of our PDB-style files is described here.)

Timeline for d5f28c_: