Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (2 families) |
Family d.88.1.1: SRF-like [55456] (5 proteins) |
Protein automated matches [191130] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [319497] (1 PDB entry) |
Domain d5f28c_: 5f28 C: [319584] Other proteins in same PDB: d5f28e_, d5f28f_, d5f28g_ automated match to d3p57j_ |
PDB Entry: 5f28 (more details), 2.9 Å
SCOPe Domain Sequences for d5f28c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f28c_ d.88.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tftkrkfglmkkayelsvlcdceialiifnstnklfqyastdmdkvllkyteynephesr tnsdivealnkk
Timeline for d5f28c_: