SCOPe 2.07: Domain d5k0ua_: 5k0u A:

Lineage for d5k0ua_ (5k0u A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Rhinovirus c [TaxId:463676] [319565] (2 PDB entries)

8. Domain d5k0ua_: 5k0u A: [319582]
   automated match to d1k5ma_

Details for d5k0ua_

PDB Entry: 5k0u, 2.79 Å

PDB Description: cryoem structure of the full virion of a human rhinovirus c

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d5k0ua_:

Sequence; same for both SEQRES and ATOM records:

>d5k0ua_ b.121.4.0 (A:) automated matches {Rhinovirus c [TaxId: 463676]}
vlvvpdtkpsgpqhttkpsilgameigassnatpestietryvyntntnaeadvemflgr
salwgkvtltrqyakweinfqeqahirkkfefftylrfdmevtivtnnkglmqimfvppg
idhpethddrkwdsasnpsvffqpksgfprftipftglasayymfydgydkpkgsdnney
giaptndmgllcfrtldnsggndvkiyvkpkhitawvprppratqythkystnyhykpns
sgpdehvlkdrhfiktrplissa

Timeline for d5k0ua_:

• d5k0ua_ first appeared in SCOPe 2.06
  
• d5k0ua_ appears in the current release, SCOPe 2.08