Lineage for d1esnb_ (1esn B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69629Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (2 proteins)
  6. 69630Protein Pantothenate kinase PanK [52587] (1 species)
  7. 69631Species Escherichia coli [TaxId:562] [52588] (2 PDB entries)
  8. 69637Domain d1esnb_: 1esn B: [31958]

Details for d1esnb_

PDB Entry: 1esn (more details), 2.6 Å

PDB Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a

SCOP Domain Sequences for d1esnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esnb_ c.37.1.6 (B:) Pantothenate kinase PanK {Escherichia coli}
lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis
snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd
gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd
ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf
regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh
aveevrlrk

SCOP Domain Coordinates for d1esnb_:

Click to download the PDB-style file with coordinates for d1esnb_.
(The format of our PDB-style files is described here.)

Timeline for d1esnb_: