Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) |
Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (2 proteins) |
Protein Pantothenate kinase PanK [52587] (1 species) |
Species Escherichia coli [TaxId:562] [52588] (2 PDB entries) |
Domain d1esnb_: 1esn B: [31958] |
PDB Entry: 1esn (more details), 2.6 Å
SCOP Domain Sequences for d1esnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esnb_ c.37.1.6 (B:) Pantothenate kinase PanK {Escherichia coli} lmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyis snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittd gflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgd ktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkf regaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanh aveevrlrk
Timeline for d1esnb_: