Lineage for d1esna_ (1esn A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23100Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (2 proteins)
  6. 23101Protein Pantothenate kinase PanK [52587] (1 species)
  7. 23102Species Escherichia coli [TaxId:562] [52588] (2 PDB entries)
  8. 23107Domain d1esna_: 1esn A: [31957]

Details for d1esna_

PDB Entry: 1esn (more details), 2.6 Å

PDB Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a

SCOP Domain Sequences for d1esna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esna_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli}
qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
nhaveevrlrk

SCOP Domain Coordinates for d1esna_:

Click to download the PDB-style file with coordinates for d1esna_.
(The format of our PDB-style files is described here.)

Timeline for d1esna_: