Lineage for d5jjaa1 (5jja A:30-375)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333198Family a.118.1.20: B56-like [140819] (1 protein)
    Pfam PF01603; Protein phosphatase 2A regulatory B subunit family
  6. 2333199Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species)
  7. 2333200Species Human (Homo sapiens) [TaxId:9606] [140821] (5 PDB entries)
    Uniprot Q13362 30-372! Uniprot Q13362 38-425
  8. 2333202Domain d5jjaa1: 5jja A:30-375 [319562]
    Other proteins in same PDB: d5jjaa2
    automated match to d2jaka1

Details for d5jjaa1

PDB Entry: 5jja (more details), 2.35 Å

PDB Description: crystal structure of a pp2a b56gamma/bubr1 complex
PDB Compounds: (A:) serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform

SCOPe Domain Sequences for d5jjaa1:

Sequence, based on SEQRES records: (download)

>d5jjaa1 a.118.1.20 (A:30-375) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
irdvppadqeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvite
piypevvhmfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespd
fqpniakkyidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnify
rfiyetehhngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlay
cvvqflekdstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfr
qlakcvssphfqvaeralyywnneyimslisdnaakilpimfpsly

Sequence, based on observed residues (ATOM records): (download)

>d5jjaa1 a.118.1.20 (A:30-375) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
irdvppadqeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvite
piypevvhmfavnmfrtlppeptleaawphlqlvyefflrflespdfqpniakkyidqkf
vlqllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyetehhngiae
lleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflekdstlte
pvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvssphfqva
eralyywnneyimslisdnaakilpimfpsly

SCOPe Domain Coordinates for d5jjaa1:

Click to download the PDB-style file with coordinates for d5jjaa1.
(The format of our PDB-style files is described here.)

Timeline for d5jjaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jjaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5jjab_