Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries) |
Domain d5i6oa2: 5i6o A:167-339 [319556] Other proteins in same PDB: d5i6oa1 automated match to d2bw4a2 complexed with 2no, cu, no has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5i6o (more details), 1.45 Å
SCOPe Domain Sequences for d5i6oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i6oa2 b.6.1.3 (A:167-339) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpas
Timeline for d5i6oa2: