Lineage for d5buoa_ (5buo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323361Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2323420Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)
  5. 2323432Family a.47.4.0: automated matches [191661] (1 protein)
    not a true family
  6. 2323433Protein automated matches [191241] (2 species)
    not a true protein
  7. 2323434Species Human (Homo sapiens) [TaxId:9606] [189704] (7 PDB entries)
  8. 2323443Domain d5buoa_: 5buo A: [319552]
    automated match to d4yn0b_
    complexed with act, ca, gol, ids, mg, scn, sgn, so4, zn

Details for d5buoa_

PDB Entry: 5buo (more details), 2.31 Å

PDB Description: a receptor molecule
PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d5buoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5buoa_ a.47.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviqhfqekvesleq
eaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkd
rqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevde
llqke

SCOPe Domain Coordinates for d5buoa_:

Click to download the PDB-style file with coordinates for d5buoa_.
(The format of our PDB-style files is described here.)

Timeline for d5buoa_: