Lineage for d1esmc_ (1esm C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23100Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (2 proteins)
  6. 23101Protein Pantothenate kinase PanK [52587] (1 species)
  7. 23102Species Escherichia coli [TaxId:562] [52588] (2 PDB entries)
  8. 23105Domain d1esmc_: 1esm C: [31955]

Details for d1esmc_

PDB Entry: 1esm (more details), 2.5 Å

PDB Description: structural basis for the feedback regulation of escherichia coli pantothenate kinase by coenzyme a

SCOP Domain Sequences for d1esmc_:

Sequence, based on SEQRES records: (download)

>d1esmc_ c.37.1.6 (C:) Pantothenate kinase PanK {Escherichia coli}
qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
gdktvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrfl
kfregaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksa
nhaveevrlrk

Sequence, based on observed residues (ATOM records): (download)

>d1esmc_ c.37.1.6 (C:) Pantothenate kinase PanK {Escherichia coli}
qtlmtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfy
issnlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelit
tdgflhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipd
gdktvvqpdilileglnvlqsgmdphhvfvsdfvdfsiyvdapedllqtwyinrflkfre
gaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhav
eevrlrk

SCOP Domain Coordinates for d1esmc_:

Click to download the PDB-style file with coordinates for d1esmc_.
(The format of our PDB-style files is described here.)

Timeline for d1esmc_: