Lineage for d5cg7a_ (5cg7 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2413579Protein automated matches [196175] (7 species)
    not a true protein
  7. 2413590Species Leishmania sp. [TaxId:438838] [319546] (1 PDB entry)
  8. 2413591Domain d5cg7a_: 5cg7 A: [319547]
    automated match to d1amka_
    complexed with gol

Details for d5cg7a_

PDB Entry: 5cg7 (more details), 1.88 Å

PDB Description: leishmania siamensis triosephosphate isomerase
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5cg7a_:

Sequence, based on SEQRES records: (download)

>d5cg7a_ c.1.1.1 (A:) automated matches {Leishmania sp. [TaxId: 438838]}
akpqpivaanwkcngttasieklvqvlnehqidhdvqcvvapsfvhipmvqaklcnpkya
vsaenaiaksgaftgevsmpilkdlgvswvilghserrtyygetdgvvaqkvadaynqgf
mviacigetlqqreanqtakvvlsqtaaiaaklpkeawsqivlayepvwaigtgkvatpe
qaqevhallrqwvsekigngvatklrilyggsvtagnaktlymkpdingflvggaslkpe
frdiidatr

Sequence, based on observed residues (ATOM records): (download)

>d5cg7a_ c.1.1.1 (A:) automated matches {Leishmania sp. [TaxId: 438838]}
akpqpivaanwkcngttasieklvqvlnehqidhdvqcvvapsfvhipmvqaklcnpkya
vsaenaiaksgaftgevsmpilkdlgvswvilghserrtyygetdgvvaqkvadaynqgf
mviacigetlqqreanqtakvvlsqtaaiaaklpkeawsqivlayepvwaivatpeqaqe
vhallrqwvsekigngvatklrilyggsvtagnaktlymkpdingflvggaslkpefrdi
idatr

SCOPe Domain Coordinates for d5cg7a_:

Click to download the PDB-style file with coordinates for d5cg7a_.
(The format of our PDB-style files is described here.)

Timeline for d5cg7a_: