![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries) |
![]() | Domain d5i6la1: 5i6l A:8-166 [319544] Other proteins in same PDB: d5i6la2 automated match to d1kcba1 complexed with act, cu, mli, no2 |
PDB Entry: 5i6l (more details), 1.08 Å
SCOPe Domain Sequences for d5i6la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i6la1 b.6.1.3 (A:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]} distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d5i6la1: