| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein 1-Cys peroxiredoxin [52909] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52910] (3 PDB entries) |
| Domain d5b6nb_: 5b6n B: [319540] automated match to d1prxb_ |
PDB Entry: 5b6n (more details), 2.9 Å
SCOPe Domain Sequences for d5b6nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6nb_ c.47.1.10 (B:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
glllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapefak
rnvklialsidsvedhlawskdinaynceepteklpfpiiddrnrelaillgmldpaekd
ekgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkd
gdsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp
Timeline for d5b6nb_: