Lineage for d5fnba_ (5fnb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (13 species)
    not a true protein
  7. 2329057Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2329073Domain d5fnba_: 5fnb A: [319539]
    automated match to d3fjwa_
    complexed with ca, hem, so4; mutant

Details for d5fnba_

PDB Entry: 5fnb (more details), 1.79 Å

PDB Description: crystal structure of fungal versatile peroxidase from pleurotus eryngii septuple mutant e37k, h39r, v160a, t184m, q202l, d213a & g330r
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d5fnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fnba_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgekvreslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspaevvwllashsiaaadkvdps
ipgmpfdstpgvfdsqffietllkgrlfpgtaankgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpaltadpgpvtsvppvp

SCOPe Domain Coordinates for d5fnba_:

Click to download the PDB-style file with coordinates for d5fnba_.
(The format of our PDB-style files is described here.)

Timeline for d5fnba_: