![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries) |
![]() | Domain d5jdbd_: 5jdb D: [319537] automated match to d2dwra_ |
PDB Entry: 5jdb (more details), 1.9 Å
SCOPe Domain Sequences for d5jdbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jdbd_ b.29.1.0 (D:) automated matches {Rotavirus a [TaxId: 28875]} ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra ttdssntanlndisiiihsefyiiprsqeskcneyinngl
Timeline for d5jdbd_: