Lineage for d5hpya_ (5hpy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332578Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2332579Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2332617Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2332618Protein automated matches [226932] (3 species)
    not a true protein
  7. 2332621Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)
  8. 2332634Domain d5hpya_: 5hpy A: [319536]
    Other proteins in same PDB: d5hpyb_, d5hpyf_
    automated match to d5c5sc_
    complexed with gdp, mg, mgf

Details for d5hpya_

PDB Entry: 5hpy (more details), 2.4 Å

PDB Description: crystal structure of rhoa.gdp.mgf3-in complex with human myosin 9b rhogap domain
PDB Compounds: (A:) Unconventional myosin-IXb

SCOPe Domain Sequences for d5hpya_:

Sequence, based on SEQRES records: (download)

>d5hpya_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghfgvcvdsltsdkasvpivlekllehvemhglyteglyrksgaanrtrelrqalqtdpa
avklenfpihaitgvlkqwlrelpeplmtfaqygdflravelpekqeqlaaiyavlehlp
eanhnslerlifhlvkvalledvnrmspgalaiifapcllrcpdnsdpltsmkdvlkitt
cvemlikeqmrkykvkmeeisql

Sequence, based on observed residues (ATOM records): (download)

>d5hpya_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghfgvcvsvpivlekllehvemhglyteglyrksgaanrtrelrqalqtdpaavklenfp
ihaitgvlkqwlrelpeplmtfaqygdflravelpekqeqlaaiyavlehlpeanhnsle
rlifhlvkvalledvnrmspgalaiifapcllrcsdpltsmkdvlkittcvemlikeqmr
kykvkmeeisql

SCOPe Domain Coordinates for d5hpya_:

Click to download the PDB-style file with coordinates for d5hpya_.
(The format of our PDB-style files is described here.)

Timeline for d5hpya_: