Lineage for d5it6a_ (5it6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780743Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 2780760Domain d5it6a_: 5it6 A: [319521]
    automated match to d3b9ca_
    complexed with edo, peg, pge, so4

Details for d5it6a_

PDB Entry: 5it6 (more details), 1.55 Å

PDB Description: galectin-related protein: an integral member of the network of chicken galectins
PDB Compounds: (A:) galectin-related protein

SCOPe Domain Sequences for d5it6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5it6a_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pfcghikggmrpgkkilvmgivdlnpesfgisltcgesedppadvaielkavftdrqfir
nscvagewgeeqssipyfpfipdqpfrveilcehprfrifvdghqlfdfyhrietlsaid
tikingdlqltklg

SCOPe Domain Coordinates for d5it6a_:

Click to download the PDB-style file with coordinates for d5it6a_.
(The format of our PDB-style files is described here.)

Timeline for d5it6a_: