Lineage for d1a7ja_ (1a7j A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. Protein Phosphoribulokinase [52585] (1 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [52586] (1 PDB entry)
  8. Domain d1a7ja_: 1a7j A: [31952]
    complexed with so4

Details for d1a7ja_

PDB Entry: 1a7j (more details), 2.5 Å

PDB Description: phosphoribulokinase from rhodobacter spheroides
PDB Compounds: (A:) phosphoribulokinase

SCOPe Domain Sequences for d1a7ja_:

Sequence, based on SEQRES records: (download)

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}
skkhpiisvtgssgagtstvkhtfdqifrregvkavsiegdafhrfnradmkaeldrrya
agdatfshfsyeanelkelervfreygetgqgrtrtyvhddaeaartgvapgnftdwrdf
dsdshllfyeglhgavvnsevniagladlkigvvpvinlewiqkihrdratrgytteavt
dvilrrmhayvhcivpqfsqtdinfqrvpvvdtsnpfiarwiptadesvvvirfrnprgi
dfpyltsmihgswmsransivvpgnkldlamqliltplidrvvreskv

Sequence, based on observed residues (ATOM records): (download)

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}
skkhpiisvtgsststvkhtfdqifrregvkavsiegdafhrfnradmkaeldrryaagd
atfshfsyeanelkelervfreygetgqgrtrtyvartgvapgnftdwrdfdsdshllfy
eglhgavvnsevniagladlkigvvpvinlewiqkihrdratrgytteavtdvilrrmha
yvhcivpqfsqtdinfqrvpvvdtsnpfiarwiptadesvvvirfrnprgidfpyltsmi
hgswmsransivvpgnkldlamqliltplidrvvreskv

SCOPe Domain Coordinates for d1a7ja_ are not available.

Timeline for d1a7ja_: