Lineage for d1nsta_ (1nst A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109945Protein Heparan sulfate N-deacetylase/N-sulfotransferase domain [52582] (1 species)
  7. 2109946Species Human (Homo sapiens) [TaxId:9606] [52583] (1 PDB entry)
  8. 2109947Domain d1nsta_: 1nst A: [31951]
    complexed with a3p

Details for d1nsta_

PDB Entry: 1nst (more details), 2.3 Å

PDB Description: the sulfotransferase domain of human haparin sulfate n-deacetylase/n-sulfotransferase
PDB Compounds: (A:) heparan sulfate n-deacetylase/n-sulfotransferase

SCOPe Domain Sequences for d1nsta_:

Sequence, based on SEQRES records: (download)

>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]}
dplwqdpcedkrhkdiwskektcdrfpklliigpqktgttalylflgmhpdlssnypsse
tfeeiqffnghnyhkgidwymeffpipsnttsdfyfeksanyfdsevaprraaallpkak
vltilinpadrayswyqhqrahddpvalkytfhevitagsdassklralqnrclvpgwya
thierwlsayhanqilvldgkllrtepakvmdmvqkflgvtntidyhktlafdpkkgfwc
qlleggktkclgkskgrkypemdldsraflkdyyrdhnielskllykmgqtlptwlredl
q

Sequence, based on observed residues (ATOM records): (download)

>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]}
dplwqdpccdrfpklliigpqktgttalylflgmhpdlssnypssetfeeiqffnghnyh
kgidwymeffpisdfyfeksanyfdsevaprraaallpkakvltilinpadrayswyqhq
rahddpvalkytfhevitagsdassklralqnrclvpgwyathierwlsayhanqilvld
gkllrtepakvmdmvqkflgvtntidyhktlafdpkkgfwcqlleggktkclgkskgrky
pemdldsraflkdyyrdhnielskllykmgqtlptwlredlq

SCOPe Domain Coordinates for d1nsta_:

Click to download the PDB-style file with coordinates for d1nsta_.
(The format of our PDB-style files is described here.)

Timeline for d1nsta_: