Lineage for d5bmvd2 (5bmv D:246-441)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201498Protein Tubulin beta-subunit [55313] (2 species)
  7. 2201499Species Cow (Bos taurus) [TaxId:9913] [64322] (11 PDB entries)
    Uniprot P02554
  8. 2201503Domain d5bmvd2: 5bmv D:246-441 [319508]
    Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb1, d5bmvc1, d5bmvc2, d5bmvd1, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3
    automated match to d1sa0b2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb

Details for d5bmvd2

PDB Entry: 5bmv (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-vinblastine complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5bmvd2:

Sequence, based on SEQRES records: (download)

>d5bmvd2 d.79.2.1 (D:246-441) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5bmvd2 d.79.2.1 (D:246-441) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltltvpeltqqmfdaknmmaacdprhgrylt
vaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignst
aiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5bmvd2:

Click to download the PDB-style file with coordinates for d5bmvd2.
(The format of our PDB-style files is described here.)

Timeline for d5bmvd2: