Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein Tubulin beta-subunit [52496] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [63990] (11 PDB entries) Uniprot P02550 ! Uniprot P02554 |
Domain d5bmvd1: 5bmv D:1-245 [319507] Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb2, d5bmvc1, d5bmvc2, d5bmvd2, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3 automated match to d1sa0b1 complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb |
PDB Entry: 5bmv (more details), 2.5 Å
SCOPe Domain Sequences for d5bmvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bmvd1 c.32.1.1 (D:1-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5bmvd1: