Lineage for d5g2gb_ (5g2g B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543464Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2543677Protein automated matches [260878] (2 species)
    not a true protein
  7. 2543687Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries)
  8. 2543689Domain d5g2gb_: 5g2g B: [319506]
    automated match to d3rgra_
    complexed with equ; mutant

Details for d5g2gb_

PDB Entry: 5g2g (more details), 1.6 Å

PDB Description: crystal structure of ketosteroid isomerase containing m116k mutation in the equilenin-bound form
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d5g2gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g2gb_ d.17.4.3 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtkqaywse
vnlsvr

SCOPe Domain Coordinates for d5g2gb_:

Click to download the PDB-style file with coordinates for d5g2gb_.
(The format of our PDB-style files is described here.)

Timeline for d5g2gb_: