Lineage for d5icma1 (5icm A:5-256)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2427753Protein automated matches [190085] (51 species)
    not a true protein
  7. 2427987Species Human (Homo sapiens) [TaxId:9606] [186828] (23 PDB entries)
  8. 2428002Domain d5icma1: 5icm A:5-256 [319504]
    Other proteins in same PDB: d5icma2
    automated match to d1ydef_
    complexed with f45, glc, na, nad

Details for d5icma1

PDB Entry: 5icm (more details), 1.68 Å

PDB Description: 17beta-hydroxysteroid dehydrogenase type 14 in complex with a non- steroidal inhibitor
PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d5icma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icma1 c.2.1.2 (A:5-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvt
qeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkl
alpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncisp
gniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiell
vtggaelgygck

SCOPe Domain Coordinates for d5icma1:

Click to download the PDB-style file with coordinates for d5icma1.
(The format of our PDB-style files is described here.)

Timeline for d5icma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5icma2