Lineage for d1cjma_ (1cjm A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243145Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 243146Protein Aryl sulfotransferase sult1a3 [52580] (1 species)
  7. 243147Species Human (Homo sapiens) [TaxId:9606] [52581] (1 PDB entry)
  8. 243148Domain d1cjma_: 1cjm A: [31950]

Details for d1cjma_

PDB Entry: 1cjm (more details), 2.4 Å

PDB Description: human sult1a3 with sulfate bound

SCOP Domain Sequences for d1cjma_:

Sequence, based on SEQRES records: (download)

>d1cjma_ c.37.1.5 (A:) Aryl sulfotransferase sult1a3 {Human (Homo sapiens)}
srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqggdl
ekcnrapiyvrvpflevndpgepsgletlkdtppprlikshlplallpqtlldqkvkvvy
varnpkdvavsyyhfhrmekahpepgtwdsflekfmagevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvgrslpeetmdfmvqhtsfkemkknpmtnyttvpqel
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrs

Sequence, based on observed residues (ATOM records): (download)

>d1cjma_ c.37.1.5 (A:) Aryl sulfotransferase sult1a3 {Human (Homo sapiens)}
srppleyvkgvplikyfaealgplqsfqarpddllintypksgttwvsqildmiyqrvpf
levndpgepetlkdtppprlikshlplallpqtlldqkvkvvyvarnpkdvavsyyhfhr
mekahpepgtwdsflekfmagevsygswyqhvqewwelsrthpvlylfyedmkenpkrei
qkilefvgrslgdwkttftvaqnerfdadyaekmagcslsfrs

SCOP Domain Coordinates for d1cjma_:

Click to download the PDB-style file with coordinates for d1cjma_.
(The format of our PDB-style files is described here.)

Timeline for d1cjma_: