Lineage for d5f28g_ (5f28 G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313764Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 2313765Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
    automatically mapped to Pfam PF03623
  6. 2313787Protein automated matches [190364] (2 species)
    not a true protein
  7. 2313796Species Mouse (Mus musculus) [TaxId:10090] [319481] (1 PDB entry)
  8. 2313799Domain d5f28g_: 5f28 G: [319495]
    Other proteins in same PDB: d5f28a_, d5f28b_, d5f28c_, d5f28d_
    automated match to d1k05b_

Details for d5f28g_

PDB Entry: 5f28 (more details), 2.9 Å

PDB Description: crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
PDB Compounds: (G:) Focal adhesion kinase 1

SCOPe Domain Sequences for d5f28g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f28g_ a.24.14.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipal
pasthreiemaqkllnsdlgeliskmklaqqyvmtslqqeykkqmltaahalavdaknll
dvidqarlkmlgq

SCOPe Domain Coordinates for d5f28g_:

Click to download the PDB-style file with coordinates for d5f28g_.
(The format of our PDB-style files is described here.)

Timeline for d5f28g_: