![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries) |
![]() | Domain d5f0vd2: 5f0v D:271-393 [319491] Other proteins in same PDB: d5f0va3, d5f0vb3, d5f0vc3, d5f0vd3 automated match to d4wysa2 complexed with edo |
PDB Entry: 5f0v (more details), 1.8 Å
SCOPe Domain Sequences for d5f0vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f0vd2 c.95.1.0 (D:271-393) automated matches {Escherichia coli [TaxId: 83333]} tplariksyasggvppalmgmgpvpatqkalqlaglqladidlieaneafaaqflavgkn lgfdsekvnvnggaialghpigasgarilvtllhamqardktlglatlcigggqgiamvi erl
Timeline for d5f0vd2: