Lineage for d5f0vd2 (5f0v D:271-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917691Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries)
  8. 2917699Domain d5f0vd2: 5f0v D:271-393 [319491]
    Other proteins in same PDB: d5f0va3, d5f0vb3, d5f0vc3, d5f0vd3
    automated match to d4wysa2
    complexed with edo

Details for d5f0vd2

PDB Entry: 5f0v (more details), 1.8 Å

PDB Description: x-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution
PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d5f0vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0vd2 c.95.1.0 (D:271-393) automated matches {Escherichia coli [TaxId: 83333]}
tplariksyasggvppalmgmgpvpatqkalqlaglqladidlieaneafaaqflavgkn
lgfdsekvnvnggaialghpigasgarilvtllhamqardktlglatlcigggqgiamvi
erl

SCOPe Domain Coordinates for d5f0vd2:

Click to download the PDB-style file with coordinates for d5f0vd2.
(The format of our PDB-style files is described here.)

Timeline for d5f0vd2: