Lineage for d1efhb_ (1efh B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23081Family c.37.1.5: PAPS sulfotransferase [52575] (4 proteins)
  6. 23096Protein Hydroxysteroid sulfotransferase [52578] (1 species)
  7. 23097Species Human (Homo sapiens) [TaxId:9606] [52579] (1 PDB entry)
  8. 23099Domain d1efhb_: 1efh B: [31949]

Details for d1efhb_

PDB Entry: 1efh (more details), 2.4 Å

PDB Description: crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
PDB Compounds: (B:)

SCOP Domain Sequences for d1efhb_:

Sequence, based on SEQRES records: (download)

>d1efhb_ c.37.1.5 (B:) Hydroxysteroid sulfotransferase {Human (Homo sapiens)}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
qllrkgvsgdwknhftvaqaedfdklfqekmadlprklaaaleh

Sequence, based on observed residues (ATOM records): (download)

>d1efhb_ c.37.1.5 (B:) Hydroxysteroid sulfotransferase {Human (Homo sapiens)}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvkaql
lrkgvsgdwknhftvaqaedfdklfqekmadlprklaaaleh

SCOP Domain Coordinates for d1efhb_:

Click to download the PDB-style file with coordinates for d1efhb_.
(The format of our PDB-style files is described here.)

Timeline for d1efhb_: