Lineage for d1efhb1 (1efh B:4-285)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109948Protein Hydroxysteroid sulfotransferase sult2a1 [52578] (1 species)
  7. 2109949Species Human (Homo sapiens) [TaxId:9606] [52579] (6 PDB entries)
  8. 2109952Domain d1efhb1: 1efh B:4-285 [31949]
    Other proteins in same PDB: d1efha2, d1efhb2
    complexed with a3p

Details for d1efhb1

PDB Entry: 1efh (more details), 2.4 Å

PDB Description: crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
PDB Compounds: (B:) hydroxysteroid sulfotransferase

SCOPe Domain Sequences for d1efhb1:

Sequence, based on SEQRES records: (download)

>d1efhb1 c.37.1.5 (B:4-285) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
qllrkgvsgdwknhftvaqaedfdklfqekmadlprklaaal

Sequence, based on observed residues (ATOM records): (download)

>d1efhb1 c.37.1.5 (B:4-285) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvkaql
lrkgvsgdwknhftvaqaedfdklfqekmadlprklaaal

SCOPe Domain Coordinates for d1efhb1:

Click to download the PDB-style file with coordinates for d1efhb1.
(The format of our PDB-style files is described here.)

Timeline for d1efhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efhb2