![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries) |
![]() | Domain d5f38d2: 5f38 D:271-392 [319488] Other proteins in same PDB: d5f38c3, d5f38d3 automated match to d4wysa2 complexed with 5ug, coz, edo |
PDB Entry: 5f38 (more details), 1.9 Å
SCOPe Domain Sequences for d5f38d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f38d2 c.95.1.0 (D:271-392) automated matches {Escherichia coli [TaxId: 83333]} tplariksyasggvppalmgmgpvpatqkalqlaglqladidlieaneafaaqflavgkn lgfdsekvnvnggaialghpigasgarilvtllhamqardktlglatlcigggqgiamvi er
Timeline for d5f38d2: