SCOPe 2.07: Domain d5f0vc1: 5f0v C:1-270

Lineage for d5f0vc1 (5f0v C:1-270)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries)

8. Domain d5f0vc1: 5f0v C:1-270 [319483]
   Other proteins in same PDB: d5f0va3, d5f0vb3, d5f0vc3, d5f0vd3
   automated match to d4wysa1
   complexed with edo

Details for d5f0vc1

PDB Entry: 5f0v, 1.8 Å

PDB Description: x-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution

PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d5f0vc1:

Sequence; same for both SEQRES and ATOM records:

>d5f0vc1 c.95.1.0 (C:1-270) automated matches {Escherichia coli [TaxId: 83333]}
mkncvivsavrtaigsfngslastsaidlgatvikaaierakidsqhvdevimgnvlqag
lgqnparqallksglaetvcgftvnkvcgsglksvalaaqaiqagqaqsivaggmenmsl
apylldakarsgyrlgdgqvydvilrdglmcathgyhmgitaenvakeygitremqdela
lhsqrkaaaaiesgaftaeivpvnvvtrkktfvfsqdefpkanstaealgalrpafdkag
tvtagnasgindgaaalvimeesaalaagl

Timeline for d5f0vc1:

• d5f0vc1 first appeared in SCOPe 2.06
  
• d5f0vc1 appears in the current release, SCOPe 2.08