![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) ![]() |
![]() | Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins) automatically mapped to Pfam PF03623 |
![]() | Protein automated matches [190364] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [319481] (1 PDB entry) |
![]() | Domain d5f28e_: 5f28 E: [319482] Other proteins in same PDB: d5f28a_, d5f28b_, d5f28c_, d5f28d_ automated match to d1k05b_ |
PDB Entry: 5f28 (more details), 2.9 Å
SCOPe Domain Sequences for d5f28e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f28e_ a.24.14.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipalp asthreiemaqkllnsdlgeliskmklaqqyvmtslqqeykkqmltaahalavdaknlld vidqarlk
Timeline for d5f28e_: