SCOPe 2.06: Domain d5bt0a1: 5bt0 A:3-234

Lineage for d5bt0a1 (5bt0 A:3-234)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d5bt0a1: 5bt0 A:3-234 [319475]
   Other proteins in same PDB: d5bt0a2, d5bt0b2
   automated match to d2hcga_
   complexed with so4

Details for d5bt0a1

PDB Entry: 5bt0, 2.03 Å

PDB Description: switching gfp fluorescence using genetically encoded phenyl azide chemistry through two different non-native post-translational modifications routes at the same position.

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5bt0a1:

Sequence; same for both SEQRES and ATOM records:

>d5bt0a1 d.22.1.1 (A:3-234) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnsxnvyitadkqkngikanfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithgmd

Timeline for d5bt0a1:

• d5bt0a1 is new in SCOPe 2.06-stable
  
• d5bt0a1 appears in SCOPe 2.07
  
• d5bt0a1 appears in the current release, SCOPe 2.08