Lineage for d1bo6b_ (1bo6 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179379Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
  6. 179383Protein Estrogen sulfotransferase [52576] (2 species)
  7. 179387Species Mouse (Mus musculus) [TaxId:10090] [52577] (3 PDB entries)
  8. 179393Domain d1bo6b_: 1bo6 B: [31947]

Details for d1bo6b_

PDB Entry: 1bo6 (more details), 2.1 Å

PDB Description: estrogen sulfotransferase with inactive cofactor pap and vanadate

SCOP Domain Sequences for d1bo6b_:

Sequence, based on SEQRES records: (download)

>d1bo6b_ c.37.1.5 (B:) Estrogen sulfotransferase {Mouse (Mus musculus)}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme

Sequence, based on observed residues (ATOM records): (download)

>d1bo6b_ c.37.1.5 (B:) Estrogen sulfotransferase {Mouse (Mus musculus)}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeke
daifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrna
kdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmf
yedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkv
spfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme

SCOP Domain Coordinates for d1bo6b_:

Click to download the PDB-style file with coordinates for d1bo6b_.
(The format of our PDB-style files is described here.)

Timeline for d1bo6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bo6a_