Lineage for d5cdka1 (5cdk A:2-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851408Family c.8.5.0: automated matches [227259] (1 protein)
    not a true family
  6. 2851409Protein automated matches [227050] (2 species)
    not a true protein
  7. 2851410Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [319461] (2 PDB entries)
  8. 2851411Domain d5cdka1: 5cdk A:2-181 [319462]
    Other proteins in same PDB: d5cdka2
    automated match to d1la1a_

Details for d5cdka1

PDB Entry: 5cdk (more details), 1.5 Å

PDB Description: apical domain of chloroplast chaperonin 60b1
PDB Compounds: (A:) Chaperonin 60B1

SCOPe Domain Sequences for d5cdka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cdka1 c.8.5.0 (A:2-181) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
qfergytspyfvtdpermiceyenckillvdkkistardiitilesairgnypllimaee
veqealatlvvnklrgtlkvvaikapgfgerrssylediailtggtvvrdemgvsleqat
davlgtaakititkerttvvgdgstaadvaarvkqirnlqmqtdqdyereklqeriarls

SCOPe Domain Coordinates for d5cdka1:

Click to download the PDB-style file with coordinates for d5cdka1.
(The format of our PDB-style files is described here.)

Timeline for d5cdka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cdka2