SCOPe 2.08: Domain d5cdka1: 5cdk A:2-181

Lineage for d5cdka1 (5cdk A:2-181)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.0: automated matches [227259] (1 protein)
   not a true family

6. Protein automated matches [227050] (2 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [319461] (2 PDB entries)

8. Domain d5cdka1: 5cdk A:2-181 [319462]
   Other proteins in same PDB: d5cdka2
   automated match to d1la1a_

Details for d5cdka1

PDB Entry: 5cdk, 1.5 Å

PDB Description: apical domain of chloroplast chaperonin 60b1

PDB Compounds: (A:) Chaperonin 60B1

SCOPe Domain Sequences for d5cdka1:

Sequence; same for both SEQRES and ATOM records:

>d5cdka1 c.8.5.0 (A:2-181) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
qfergytspyfvtdpermiceyenckillvdkkistardiitilesairgnypllimaee
veqealatlvvnklrgtlkvvaikapgfgerrssylediailtggtvvrdemgvsleqat
davlgtaakititkerttvvgdgstaadvaarvkqirnlqmqtdqdyereklqeriarls

Timeline for d5cdka1:

• d5cdka1 first appeared in SCOPe 2.06
  
• d5cdka1 appears in SCOPe 2.07