Lineage for d1bo6a_ (1bo6 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243145Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 243149Protein Estrogen sulfotransferase [52576] (2 species)
  7. 243153Species Mouse (Mus musculus) [TaxId:10090] [52577] (3 PDB entries)
  8. 243158Domain d1bo6a_: 1bo6 A: [31946]

Details for d1bo6a_

PDB Entry: 1bo6 (more details), 2.1 Å

PDB Description: estrogen sulfotransferase with inactive cofactor pap and vanadate

SCOP Domain Sequences for d1bo6a_:

Sequence, based on SEQRES records: (download)

>d1bo6a_ c.37.1.5 (A:) Estrogen sulfotransferase {Mouse (Mus musculus)}
peyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeg
dvekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckm
iylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskn
srvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpe
emmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme

Sequence, based on observed residues (ATOM records): (download)

>d1bo6a_ c.37.1.5 (A:) Estrogen sulfotransferase {Mouse (Mus musculus)}
peyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeg
daifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrna
kdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmf
yedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkv
spfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme

SCOP Domain Coordinates for d1bo6a_:

Click to download the PDB-style file with coordinates for d1bo6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bo6a_: