SCOPe 2.07: Domain d5bmve_: 5bmv E:

Lineage for d5bmve_ (5bmv E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)

8. Domain d5bmve_: 5bmv E: [319457]
   Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb1, d5bmvb2, d5bmvc1, d5bmvc2, d5bmvd1, d5bmvd2, d5bmvf1, d5bmvf2, d5bmvf3
   automated match to d4i55e_
   complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb

Details for d5bmve_

PDB Entry: 5bmv, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-vinblastine complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5bmve_:

Sequence, based on SEQRES records:

>d5bmve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d5bmve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d5bmve_:

• d5bmve_ first appeared in SCOPe 2.06
  
• d5bmve_ appears in the current release, SCOPe 2.08