Lineage for d1aqyb_ (1aqy B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121866Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
  6. 121870Protein Estrogen sulfotransferase [52576] (1 species)
  7. 121871Species Mouse (Mus musculus) [TaxId:10090] [52577] (3 PDB entries)
  8. 121875Domain d1aqyb_: 1aqy B: [31945]

Details for d1aqyb_

PDB Entry: 1aqy (more details), 1.75 Å

PDB Description: estrogen sulfotransferase with pap

SCOP Domain Sequences for d1aqyb_:

Sequence, based on SEQRES records: (download)

>d1aqyb_ c.37.1.5 (B:) Estrogen sulfotransferase {Mouse (Mus musculus)}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrm

Sequence, based on observed residues (ATOM records): (download)

>d1aqyb_ c.37.1.5 (B:) Estrogen sulfotransferase {Mouse (Mus musculus)}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeed
aifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrnak
dvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmfy
edmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkvs
pfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrm

SCOP Domain Coordinates for d1aqyb_:

Click to download the PDB-style file with coordinates for d1aqyb_.
(The format of our PDB-style files is described here.)

Timeline for d1aqyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aqya_