Lineage for d1aqyb_ (1aqy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109915Protein Estrogen sulfotransferase (STE, sult1e1) [52576] (2 species)
  7. 2109927Species Mouse (Mus musculus) [TaxId:10090] [52577] (3 PDB entries)
  8. 2109931Domain d1aqyb_: 1aqy B: [31945]
    complexed with a3p

Details for d1aqyb_

PDB Entry: 1aqy (more details), 1.75 Å

PDB Description: estrogen sulfotransferase with pap
PDB Compounds: (B:) estrogen sulfotransferase

SCOPe Domain Sequences for d1aqyb_:

Sequence, based on SEQRES records: (download)

>d1aqyb_ c.37.1.5 (B:) Estrogen sulfotransferase (STE, sult1e1) {Mouse (Mus musculus) [TaxId: 10090]}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrm

Sequence, based on observed residues (ATOM records): (download)

>d1aqyb_ c.37.1.5 (B:) Estrogen sulfotransferase (STE, sult1e1) {Mouse (Mus musculus) [TaxId: 10090]}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykeed
aifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrnak
dvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfmfy
edmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqkvs
pfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrm

SCOPe Domain Coordinates for d1aqyb_:

Click to download the PDB-style file with coordinates for d1aqyb_.
(The format of our PDB-style files is described here.)

Timeline for d1aqyb_: