Lineage for d1aqya_ (1aqy A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179379Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
  6. 179383Protein Estrogen sulfotransferase [52576] (2 species)
  7. 179387Species Mouse (Mus musculus) [TaxId:10090] [52577] (3 PDB entries)
  8. 179390Domain d1aqya_: 1aqy A: [31944]

Details for d1aqya_

PDB Entry: 1aqy (more details), 1.75 Å

PDB Description: estrogen sulfotransferase with pap

SCOP Domain Sequences for d1aqya_:

Sequence, based on SEQRES records: (download)

>d1aqya_ c.37.1.5 (A:) Estrogen sulfotransferase {Mouse (Mus musculus)}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
vekckedaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmi
ylcrnakdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawwekskns
rvlfmfyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpee
mmnqkvspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme

Sequence, based on observed residues (ATOM records): (download)

>d1aqya_ c.37.1.5 (A:) Estrogen sulfotransferase {Mouse (Mus musculus)}
eyyevfgefrgvlmdkrftkywedvemflarpddlviatypksgttwisevvymiykegd
vdaifnripylecrnedlingikqlkekesprivkthlppkllpasfweknckmiylcrn
akdvavsyyyfllmitsypnpksfsefvekfmqgqvpygswydhvkawweksknsrvlfm
fyedmkedirrevvklieflerkpsaelvdriiqhtsfqemknnpstnytmmpeemmnqk
vspfmrkgiigdwknhfpealrerfdehykqqmkdctvkfrme

SCOP Domain Coordinates for d1aqya_:

Click to download the PDB-style file with coordinates for d1aqya_.
(The format of our PDB-style files is described here.)

Timeline for d1aqya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aqyb_