Lineage for d4xgsd1 (4xgs D:2-163)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702136Protein Non-hem ferritin [63524] (7 species)
  7. 2702148Species Escherichia coli [TaxId:83333] [319417] (1 PDB entry)
  8. 2702152Domain d4xgsd1: 4xgs D:2-163 [319439]
    Other proteins in same PDB: d4xgsa2, d4xgsb2, d4xgsc2, d4xgsd2, d4xgse2, d4xgsf2
    automated match to d4reua_
    complexed with gol, ofo, so4

Details for d4xgsd1

PDB Entry: 4xgs (more details), 2.25 Å

PDB Description: crystal structure analysis of novel iron uptake mechanism of gram- negative bacterial ferritin
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d4xgsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xgsd1 a.25.1.1 (D:2-163) Non-hem ferritin {Escherichia coli [TaxId: 83333]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt

SCOPe Domain Coordinates for d4xgsd1:

Click to download the PDB-style file with coordinates for d4xgsd1.
(The format of our PDB-style files is described here.)

Timeline for d4xgsd1: