![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) ![]() |
![]() | Family a.118.6.0: automated matches [267630] (1 protein) not a true family |
![]() | Protein automated matches [267683] (4 species) not a true protein |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [319437] (1 PDB entry) |
![]() | Domain d4ydoa_: 4ydo A: [319438] automated match to d4l9pa_ complexed with ca, zn |
PDB Entry: 4ydo (more details), 3 Å
SCOPe Domain Sequences for d4ydoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ydoa_ a.118.6.0 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]} tdskydysditpvdinteepqicqilydedykqimgillslmkaeeyseralhitelgin elashytiwiyrfnilknlpnrnlydeldwceeialdneknyqiwnyrqliigqimelnn ndfdpyrefpileamlssdpknhhvwsyrkwlvdtfdlhndakelsfvdkvidtdlknns awshrffllfskkhlatdntideelnyvkdkivkcpqnpstwnyllgiherfdrsitqle efslqfvdlekdqvtssfaletlakiytqqkkynesrtvydllkskydpirsnfwdyqis klt
Timeline for d4ydoa_: