Lineage for d4ydoa_ (4ydo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726441Family a.118.6.0: automated matches [267630] (1 protein)
    not a true family
  6. 2726442Protein automated matches [267683] (4 species)
    not a true protein
  7. 2726456Species Yeast (Candida albicans) [TaxId:5476] [319437] (1 PDB entry)
  8. 2726457Domain d4ydoa_: 4ydo A: [319438]
    automated match to d4l9pa_
    complexed with ca, zn

Details for d4ydoa_

PDB Entry: 4ydo (more details), 3 Å

PDB Description: crystal structure of candida albicans protein farnesyltransferase in apo form
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

SCOPe Domain Sequences for d4ydoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ydoa_ a.118.6.0 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
tdskydysditpvdinteepqicqilydedykqimgillslmkaeeyseralhitelgin
elashytiwiyrfnilknlpnrnlydeldwceeialdneknyqiwnyrqliigqimelnn
ndfdpyrefpileamlssdpknhhvwsyrkwlvdtfdlhndakelsfvdkvidtdlknns
awshrffllfskkhlatdntideelnyvkdkivkcpqnpstwnyllgiherfdrsitqle
efslqfvdlekdqvtssfaletlakiytqqkkynesrtvydllkskydpirsnfwdyqis
klt

SCOPe Domain Coordinates for d4ydoa_:

Click to download the PDB-style file with coordinates for d4ydoa_.
(The format of our PDB-style files is described here.)

Timeline for d4ydoa_: