SCOPe 2.08: Domain d4xgse1: 4xgs E:2-163

Lineage for d4xgse1 (4xgs E:2-163)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Non-hem ferritin [63524] (7 species)

7. Species Escherichia coli [TaxId:83333] [319417] (1 PDB entry)

8. Domain d4xgse1: 4xgs E:2-163 [319426]
   Other proteins in same PDB: d4xgsa2, d4xgsb2, d4xgsc2, d4xgsd2, d4xgse2, d4xgsf2
   automated match to d4reua_
   complexed with gol, ofo, so4

Details for d4xgse1

PDB Entry: 4xgs, 2.25 Å

PDB Description: crystal structure analysis of novel iron uptake mechanism of gram- negative bacterial ferritin

PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d4xgse1:

Sequence; same for both SEQRES and ATOM records:

>d4xgse1 a.25.1.1 (E:2-163) Non-hem ferritin {Escherichia coli [TaxId: 83333]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykleqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt

Timeline for d4xgse1:

• d4xgse1 first appeared in SCOPe 2.06
  
• d4xgse1 appears in SCOPe 2.07