Lineage for d5ce3c2 (5ce3 C:147-374)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883904Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [269617] (2 PDB entries)
  8. 2883907Domain d5ce3c2: 5ce3 C:147-374 [319412]
    Other proteins in same PDB: d5ce3a1, d5ce3c1
    automated match to d3ub5a2
    complexed with adp, atp, ca, mg

Details for d5ce3c2

PDB Entry: 5ce3 (more details), 2.93 Å

PDB Description: the yersinia yopo - actin complex with mgadp
PDB Compounds: (C:) actin

SCOPe Domain Sequences for d5ce3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ce3c2 c.55.1.1 (C:147-374) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataaastsleksyelpdgqviaignerfrcpealfqpsf
lgmescgihetvynsimkcdvdirkdlyantvmsggttmypgiadrmqkeitalapstik
tkiiapperkysvwiggsilaslstfqqmwiskeeydesgpgivhrkc

SCOPe Domain Coordinates for d5ce3c2:

Click to download the PDB-style file with coordinates for d5ce3c2.
(The format of our PDB-style files is described here.)

Timeline for d5ce3c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ce3c1